Iright
BRAND / VENDOR: Proteintech

Proteintech, 26706-1-AP, NPRC/NPR3 Polyclonal antibody

CATALOG NUMBER: 26706-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NPRC/NPR3 (26706-1-AP) by Proteintech is a Polyclonal antibody targeting NPRC/NPR3 in IHC, ELISA applications with reactivity to human samples 26706-1-AP targets NPRC/NPR3 in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human kidney tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information Natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C), also known as NPR3, is an atrial natriuretic peptide receptor. The family of natriuretic peptides elicit a number of vascular, renal, and endocrine effects that are important in the maintenance of blood pressure and extracellular fluid volume. NPR3 has 3 isoforms with MWs of 37~60 kDa produced by alternative splicing. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19071 Product name: Recombinant human NPR3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 48-378 aa of BC131540 Sequence: LPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEGFHDAILLYVLALHEVLRA Predict reactive species Full Name: natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C) Calculated Molecular Weight: 541 aa, 60 kDa GenBank Accession Number: BC131540 Gene Symbol: NPR3 Gene ID (NCBI): 4883 RRID: AB_2880607 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17342 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924