Proteintech, 26720-1-AP, ABCD3 Polyclonal antibody

Size: 20ul / 150ul The ABCD3 (26720-1-AP) by Proteintech is a Polyclonal antibody targeting ABCD3 in WB, ELISA applications with reactivity to human, mouse, rat samples 26720-1-AP targets ABCD3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse kidney tissue, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information ABCD3 belongs to the superfamily of ATP-binding cassette (ABC) transporters and is a peroxisomal membrane transporter involved in the transport of branched-chain fatty acids and C27 bile acids into the peroxisome. ABCD3 plays a role in the regulation of LCFAs and energy metabolism, namely in the degradation and biosynthesis of fatty acids via beta-oxidation (PMID: 24333844). Mutations in ABCD3 are associated with congenital bile acid synthesis defect 5 (CBAS5)(PMID: 25168382). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24760 Product name: Recombinant human ABCD3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-124 aa of BC068509 Sequence: MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVDKVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRKDFKR Predict reactive species Full Name: ATP-binding cassette, sub-family D (ALD), member 3 Observed Molecular Weight: 70 kDa GenBank Accession Number: BC068509 Gene Symbol: ABCD3 Gene ID (NCBI): 5825 RRID: AB_3085895 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P28288 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.