Proteintech, 26727-1-AP, SNX10 Polyclonal antibody

Size: 20ul / 150ul The SNX10 (26727-1-AP) by Proteintech is a Polyclonal antibody targeting SNX10 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26727-1-AP targets SNX10 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins classified by the presence of a phospholipid-binding motif PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. Mutations in SNX10 (Sorting nexin-10) have been found to account for approximately 4% of all human autosomal recessive osteopetrosis (ARO) that is a genetically heterogeneous disorder caused by reduced bone resorption by osteoclasts (PMID: 23280965; PMID: 28592808). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24977 Product name: Recombinant human SNX10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-201 aa of BC034992 Sequence: HLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSHGCKVNTAPQES Predict reactive species Full Name: sorting nexin 10 Calculated Molecular Weight: 201 aa, 24 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC034992 Gene Symbol: SNX10 Gene ID (NCBI): 29887 RRID: AB_3085897 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5X0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.