Iright
BRAND / VENDOR: Proteintech

Proteintech, 26738-1-AP, CENPB Polyclonal antibody

CATALOG NUMBER: 26738-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CENPB (26738-1-AP) by Proteintech is a Polyclonal antibody targeting CENPB in WB, ELISA applications with reactivity to human, mouse samples 26738-1-AP targets CENPB in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Centromere protein B (CENPB), also known as major centromere autoantigen B, is an autoantigen protein of the cell nucleus. In mammalian centromeres CENPB plays a critical role in the organization of chromatinstructure, but in the absence of CENPB some chromosomes use other redundant proteins to accomplish mitosis (PMID: 14963831). CENPB plays an important role in cell cycle regulation. CENPB is highly expressed in cancer cells helping in high rate proliferation. This antibody detects CENPB protein with a molecular weight of 80 kDa (PMID: 34547289, PMID: 29273057). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24967 Product name: Recombinant human CENPB protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-180 aa of BC053847 Sequence: MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRRRHGVVSCSGVARARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRAREEQPP Predict reactive species Full Name: centromere protein B, 80kDa Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC053847 Gene Symbol: CENPB Gene ID (NCBI): 1059 RRID: AB_3085899 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07199 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924