Proteintech, 26739-1-AP, TGR5/GPBAR1 Polyclonal antibody

Size: 20ul / 150ul The TGR5/GPBAR1 (26739-1-AP) by Proteintech is a Polyclonal antibody targeting TGR5/GPBAR1 in WB, ELISA applications with reactivity to human samples 26739-1-AP targets TGR5/GPBAR1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TGR5, also known as GPBAR1 (G-protein coupled bile acid receptor 1) or M-BAR, is a cell-surface receptor for bile acid which belongs to the G-protein coupled receptor 1 family (20236244). TGR5 gene expression is widely distributed, including endocrine glands, adipocytes, muscles, immune organs, spinal cord, and the enteric nervous system (24411485, 20665558, 22521118). TGR5 activation has some important biological effects such as anti-inflammatory, energy homeostasis and metabolism, anti-apoptotic, and choleretic functions (24411485, 22521118). In addition, TGR5 is related to several diseases, such as Metabolic and cardiovascular disorders, Hepatic and pancreatic disorders, Inflammatory bowel diseases, Gastrointestinal cancer, and so on (24411485). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24893 Product name: Recombinant human GPBAR1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 250-330 aa of BC033625 Sequence: AYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN Predict reactive species Full Name: G protein-coupled bile acid receptor 1 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC033625 Gene Symbol: GPBAR1 Gene ID (NCBI): 151306 RRID: AB_3669565 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDU6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.