Proteintech, 26745-1-AP, LYPD2 Polyclonal antibody

Size: 20ul / 150ul The LYPD2 (26745-1-AP) by Proteintech is a Polyclonal antibody targeting LYPD2 in IHC, ELISA applications with reactivity to human samples 26745-1-AP targets LYPD2 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human prostate cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24986 Product name: Recombinant human LYPD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-102 aa of BC119019 Sequence: ALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIVYPFQGDSTVTKSCASKCKPSDVDGIGQTLPVSCCNTELCNV Predict reactive species Full Name: LY6/PLAUR domain containing 2 Calculated Molecular Weight: 125 aa, 13 kDa GenBank Accession Number: BC119019 Gene Symbol: LYPD2 Gene ID (NCBI): 137797 RRID: AB_3085901 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXB3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.