Proteintech, 26756-1-AP, CXCR3 Polyclonal antibody

Size: 20ul / 150ul The CXCR3 (26756-1-AP) by Proteintech is a Polyclonal antibody targeting CXCR3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26756-1-AP targets CXCR3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, mouse liver tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CXCR3 (C-X-C chemokine receptor type 3) is a G-protein-coupled seven-transmembrane domain chemokine receptor that is expressed on the surface of a number of cell types, including activated CD4+ and CD8+ T cells, NK and NK-T cells, plasmacytoid dendritic cells, and some B cells. CXCR3 is activated by three related chemokines (CXCL9, CXCL10, and CXCL11) and plays an important role in effector T-cell and NK cell trafficking. CXCR3 has three isoforms termed CXCR3-A, CXCR3-B, and CXCR3-alt with the calculated molecular mass of 41kDa, 46kDa, and 29kDa respectively. The apparent molecular mass of CXCR3 detected by some scientists is 70kDa, but 45kDa by others. (PMID: 16847335, 15150261, 22885102, 19151743) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25056 Product name: Recombinant human CXCR3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-53 aa of BC034403 Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR Predict reactive species Full Name: chemokine (C-X-C motif) receptor 3 Calculated Molecular Weight: 368 aa, 41 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC034403 Gene Symbol: CXCR3 Gene ID (NCBI): 2833 RRID: AB_2880623 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49682 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.