Iright
BRAND / VENDOR: Proteintech

Proteintech, 26768-1-AP, Plasminogen Polyclonal antibody

CATALOG NUMBER: 26768-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Plasminogen (26768-1-AP) by Proteintech is a Polyclonal antibody targeting Plasminogen in WB, IHC, ELISA applications with reactivity to human samples 26768-1-AP targets Plasminogen in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue, Raji cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Plasminogen is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin. Plasminogen plays an important role in fibrinolysis as well as wound healing, cell migration, tissue modeling and angiogenesis. Plasminogen is synthesized in the liver, and it circulates in the blood, with a half-life of 2.2 days. Plasminogen is the precursor of plasmin, which lyses fibrin clots to fibrin degradation products (FDP) and D-dimer; the conversion to active protease is mediated by tissue-type (tPA) and urokinase-type (uPA) plasminogen activators. Defects in plasminogen are likely a cause of thrombophilia and ligneous conjunctivitis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25243 Product name: Recombinant human PLG protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 17-231 aa of BC060513 Sequence: GQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKK Predict reactive species Full Name: plasminogen Calculated Molecular Weight: 810 aa, 91 kDa Observed Molecular Weight: 91 kDa GenBank Accession Number: BC060513 Gene Symbol: Plasminogen Gene ID (NCBI): 5340 RRID: AB_2880627 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00747 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924