Iright
BRAND / VENDOR: Proteintech

Proteintech, 26789-1-AP, GRLF1 Polyclonal antibody

CATALOG NUMBER: 26789-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GRLF1 (26789-1-AP) by Proteintech is a Polyclonal antibody targeting GRLF1 in WB, IHC, ELISA applications with reactivity to human samples 26789-1-AP targets GRLF1 in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells Positive IHC detected in: human colon tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GRLF1 is also named as ARHGAP35, p190ARHOGAP, KIAA1722, P190A and GRF1. GRLF1 is a kind of Rho GTPase-activating protein, and it binds several acidic phospholipids which inhibits the Rho GAP activity to promote the Rac GAP activity (PMID:19673492). This binding is inhibited by phosphorylation by PRKCA (PMID:19673492). GRLF1 is Involved in cell differentiation as well as cell adhesion and migration. And it plays an important role in retinal tissue morphogenesis, neural tube fusion, midline fusion of the cerebral hemispheres and mammary gland branching morphogenesis. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25353 Product name: Recombinant human GRLF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 890-1080 aa of BC150257 Sequence: DGAVDVLDNDLSREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEACSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPSYSLFREDTSLPSLSKDHSKLSMELEGNDGLSFIMSNFESKLNNKVPPPVKPKPPVHFEITKGDLSYLDQGHRDGQRKSVSSSPWLPQD Predict reactive species Full Name: glucocorticoid receptor DNA binding factor 1 Observed Molecular Weight: 172 kDa GenBank Accession Number: BC150257 Gene Symbol: GRLF1 Gene ID (NCBI): 2909 RRID: AB_2880636 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRY4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924