Proteintech, 26791-1-AP, CXCL2 Polyclonal antibody

Size: 20ul / 150ul The CXCL2 (26791-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL2 in WB, ELISA applications with reactivity to human, mouse, rat samples 26791-1-AP targets CXCL2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, human milk, rat lung tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information CXCL2, also known as macrophage inflammatory protein 2-alpha (MIP2-alpha), is a member of CXC chemokine family that binds to CXC chemokine receptor 2 (CXCR2). CXCL2 is mainly produced by macrophages, endothelial cells, epithelial cells and tumor cells. CXCL2 plays important roles in various biological progresses such as angiogenesis, inflammation, immune response and cancer biological behaviors. Under inflammatory conditions in CNS, microglia and astrocytes may secrete CXCL2 as well as other chemokines, which induces chemotaxis and infiltration of circulatory neutrophils. Indeed, previous studies suggest that CXCL2 is involved in Alzheimer disease, multiple sclerosis and brain ischemia. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25376 Product name: Recombinant human CXCL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 35-107 aa of BC015753 Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN Predict reactive species Full Name: chemokine (C-X-C motif) ligand 2 Calculated Molecular Weight: 107 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC015753 Gene Symbol: CXCL2 Gene ID (NCBI): 2920 RRID: AB_3085904 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19875 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.