Product Description
Size: 20ul / 150ul
The BCLAF1 (26809-1-AP) by Proteintech is a Polyclonal antibody targeting BCLAF1 in WB, IHC, ELISA applications with reactivity to human, mouse samples
26809-1-AP targets BCLAF1 in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: Jurkat cells, HEK-293 cells, MCF-7 cells
Positive IHC detected in: mouse testis tissue, human colon tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Background Information
BCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse, pig
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25210 Product name: Recombinant human BCLAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 881-920 aa of BC132780 Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE Predict reactive species
Full Name: BCL2-associated transcription factor 1
Calculated Molecular Weight: 920 aa, 106 kDa
Observed Molecular Weight: 145 kDa
GenBank Accession Number: BC132780
Gene Symbol: BCLAF1
Gene ID (NCBI): 9774
RRID: AB_2880642
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NYF8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924