Proteintech, 26812-1-AP, CLCN5 Polyclonal antibody

Size: 20ul / 150ul The CLCN5 (26812-1-AP) by Proteintech is a Polyclonal antibody targeting CLCN5 in WB, IHC, ELISA applications with reactivity to human, Canine, mouse samples 26812-1-AP targets CLCN5 in WB, IHC, IF, ELISA applications and shows reactivity with human, Canine, mouse samples. Tested Applications Positive WB detected in: MDCK cells, mouse brain tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, Canine, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25182 Product name: Recombinant human CLCN5 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 627-685 aa of BC130429 Sequence: ESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLRNILDL Predict reactive species Full Name: chloride channel 5 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 80-90 kDa GenBank Accession Number: BC130429 Gene Symbol: CLCN5 Gene ID (NCBI): 1184 RRID: AB_2880643 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P51795 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.