Iright
BRAND / VENDOR: Proteintech

Proteintech, 26828-1-AP, MRPS7 Polyclonal antibody

CATALOG NUMBER: 26828-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MRPS7 (26828-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS7 in WB, ELISA applications with reactivity to human samples 26828-1-AP targets MRPS7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25325 Product name: Recombinant human MRPS7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 46-242 aa of BC000241 Sequence: IDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYRWW Predict reactive species Full Name: mitochondrial ribosomal protein S7 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC000241 Gene Symbol: MRPS7 Gene ID (NCBI): 51081 RRID: AB_2880650 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2R9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924