Proteintech, 26830-1-AP, PLEKHA1 Polyclonal antibody

Size: 20ul / 150ul The PLEKHA1 (26830-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHA1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 26830-1-AP targets PLEKHA1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, Jurkat cells, MOLT-4 cells Positive IP detected in: A549 cells Positive IHC detected in: human colon tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Pleckstrin homology (PH) domain is commonly found in eukaryotic signaling proteins and possesses multiple functions including the abilities to bind inositol phosphates and various proteins. The tandem PH domain containing protein-1 (TAPP1) or PH domain containing-family A (phosphoinositide binding specific) member 1 (PLEKHA1), interacts strongly and specifically with phosphatidylinositol 3,4-trisphosphate [PtdIns(3,4)P(2)], which is one of the immediate breakdown products of PtdIns(3,4,5) P (3) and functions as a signalling molecule in insulin- and growth-factor-stimulated pathways. TAPP1 is also associated with the protein- tyrosine-phosphatase-like protein-1 (PTPL1 also known as FAP-1) and maintains PTPL1 in cytoplasm. By binding to PtdIns(3,4) P (2) and PTPL1, TAPP1 may regulate the membrane localization of PTPL1." Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25285 Product name: Recombinant human PLEKHA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-196 aa of BC001136 Sequence: SDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQDSAVIKAG Predict reactive species Full Name: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC001136 Gene Symbol: PLEKHA1 Gene ID (NCBI): 59338 RRID: AB_2880651 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HB21 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.