Proteintech, 26836-1-AP, ADAMTS7 Polyclonal antibody

Size: 20ul / 150ul The ADAMTS7 (26836-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTS7 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26836-1-AP targets ADAMTS7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25218 Product name: Recombinant human ADAMTS7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1507-1686 aa of BC061631 Sequence: PAKPPAHRPCGAQPCLSWYTSSWRECSEACGGGEQQRLVTCPEPGLCEEALRPNTTRPCNTHPCTQWVVGPWGQCSGPCGGGVQRRLVKCVNTQTGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR Predict reactive species Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 7 Calculated Molecular Weight: 1686 aa, 184 kDa Observed Molecular Weight: 184 kDa GenBank Accession Number: BC061631 Gene Symbol: ADAMTS7 Gene ID (NCBI): 11173 RRID: AB_2880653 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKP4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.