Iright
BRAND / VENDOR: Proteintech

Proteintech, 26849-1-AP, RRP12 Polyclonal antibody

CATALOG NUMBER: 26849-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RRP12 (26849-1-AP) by Proteintech is a Polyclonal antibody targeting RRP12 in WB, IF/ICC, ELISA applications with reactivity to human samples 26849-1-AP targets RRP12 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25271 Product name: Recombinant human RRP12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC012745 Sequence: MGRSGKLPSGVSAKLKRWKKGHSSDSNPAICRHRQAARSRFFSRPSGRSDLTVDAVKLHNELQSGSLRLGKSEAPETPMEEEAELVLTEKSSGTFLSGLSDCTNVTFSKVQRFWESNSAAHKEICAVLAAVTEVIRSQGGKETETEYFAAL Predict reactive species Full Name: ribosomal RNA processing 12 homolog (S. cerevisiae) Calculated Molecular Weight: 1297 aa, 144 kDa Observed Molecular Weight: 144-150 kDa GenBank Accession Number: BC012745 Gene Symbol: RRP12 Gene ID (NCBI): 23223 RRID: AB_3669571 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JTH9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924