Product Description
Size: 20ul / 150ul
The PTPRF (26860-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRF in WB, ELISA applications with reactivity to human samples
26860-1-AP targets PTPRF in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: MCF-7 cells, MKN-45 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Background Information
PTPRF (Protein Tyrosine Phosphatase Receptor Type F) is a receptor protein tyrosine phosphatase, also known as LAR. PTPRF is a transmembrane protein with extracellular domain, transmembrane domain and two intracellular catalytic domains in series. It is located in the cell membrane and participates in the interaction between cells or cell matrix. It is widely expressed in many tissues, including fat, skin, heart, lung, liver, kidney, pancreas, small intestine, colon, brain, skeletal muscle, spleen, peripheral white blood cells and so on. The protein plays an important role in regulating a variety of cell processes, including cell growth, differentiation, mitotic cycle and carcinogenic transformation. In the insulin-responsive tissues of obese and insulin-resistant individuals, the expression level of PTPRF is increased, which may contribute to the pathogenesis of insulin resistance. PTPRF showed expression changes in many cancers, such as breast cancer, thyroid cancer, non-small cell lung cancer and so on. In gastric adenocarcinoma, PTPRF, as a new tumor suppressor, plays a role by inactivating ERK1/2 signaling pathway (PMID: 32973331). The total length of the protein is 175-200kd, and after cutting, it forms 125-150 and 80-85kd,70 and 72kDa fragments (PMID: 1547787, PMID: 17259169).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25448 Product name: Recombinant human PTPRF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1080-1150 aa of BC048768 Sequence: HLVSIRTAPDLLPHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYIVVVPIDRVGGSMLTPRWSTPEELEL Predict reactive species
Full Name: protein tyrosine phosphatase, receptor type, F
Calculated Molecular Weight: 1898 aa, 212 kDa
Observed Molecular Weight: 70-72 kDa, 150 kDa
GenBank Accession Number: BC048768
Gene Symbol: PTPRF
Gene ID (NCBI): 5792
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P10586
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924