Proteintech, 26873-1-AP, MATE 2 Polyclonal antibody

Size: 20ul / 150ul The MATE 2 (26873-1-AP) by Proteintech is a Polyclonal antibody targeting MATE 2 in WB, ELISA applications with reactivity to human, Canine samples 26873-1-AP targets MATE 2 in WB, ELISA applications and shows reactivity with human, Canine samples. Tested Applications Positive WB detected in: MDCK cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, Canine Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25472 Product name: Recombinant human SLC47A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 469-555 aa of BC035288 Sequence: RLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITLTTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIR Predict reactive species Full Name: solute carrier family 47, member 2 Calculated Molecular Weight: 602 aa, 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC035288 Gene Symbol: MATE2/SLC47A2 Gene ID (NCBI): 146802 RRID: AB_2880664 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86VL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.