Proteintech, 26877-1-AP, TLX1 Polyclonal antibody

Size: 20ul / 150ul The TLX1 (26877-1-AP) by Proteintech is a Polyclonal antibody targeting TLX1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26877-1-AP targets TLX1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21899 Product name: Recombinant human TLX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-123 aa of BC130530 Sequence: GGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGA Predict reactive species Full Name: T-cell leukemia homeobox 1 Calculated Molecular Weight: 330 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC130530 Gene Symbol: TLX1 Gene ID (NCBI): 3195 RRID: AB_2880666 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31314 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.