Proteintech, 26880-1-AP, CNTROB Polyclonal antibody

Size: 20ul / 150ul The CNTROB (26880-1-AP) by Proteintech is a Polyclonal antibody targeting CNTROB in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 26880-1-AP targets CNTROB in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25454 Product name: Recombinant human CNTROB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC021134 Sequence: MATSADSPSSPLGAEDLLSDSSEPPGLNQVSSEVTSQLYASLRLSRQAEATARAQLYLPSTSPPHEGLDGFAQELSRSLSVGLEKNLKKKDGSKHIFEMESVRGQLQTMLQTSRDTAYRDPLIPGAGSERREEDSFDSDSTATLLNTRPLQDLSPSSSAQALEELFPRYTSLRPGPPLNPPDFQGLRDALDSEHTRRKHCERHIQSLQTRVLELQQQLAVAVAADRKKDTMIEQLDKTLARVVEGWNRHEAERTEVLRGLQEEHQAAELTRSKQQETVTRLEQSLSEAMEALNREQESARLQQRERETLEEERQALTLRLEAEQQRCCVLQEERDAARAGQLSEHRELET Predict reactive species Full Name: centrobin, centrosomal BRCA2 interacting protein Calculated Molecular Weight: 903 aa, 101 kDa Observed Molecular Weight: 60-70 kDa, 100-130 kDa GenBank Accession Number: BC021134 Gene Symbol: CNTROB Gene ID (NCBI): 116840 RRID: AB_2880667 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N137 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.