Product Description
Size: 20ul / 150ul
The SLC4A3 (26883-1-AP) by Proteintech is a Polyclonal antibody targeting SLC4A3 in WB, ELISA applications with reactivity to human, mouse samples
26883-1-AP targets SLC4A3 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse brain tissue, mouse heart tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25457 Product name: Recombinant human SLC4A3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 429-499 aa of BC146656 Sequence: NDDKDSGFFPRNPSSSSMNSVLGNHHPTPSHGPDGAVPTMADDLGEPAPLWPHDPDAKEKPLHMPGGDGHR Predict reactive species
Full Name: solute carrier family 4, anion exchanger, member 3
Calculated Molecular Weight: 1232 aa, 136 kDa
Observed Molecular Weight: 135-140 kDa,104 kDa
GenBank Accession Number: BC146656
Gene Symbol: SLC4A3
Gene ID (NCBI): 6508
RRID: AB_2918114
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P48751
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924