Proteintech, 26896-1-AP, IFT22 Polyclonal antibody

Size: 20ul / 150ul The IFT22 (26896-1-AP) by Proteintech is a Polyclonal antibody targeting IFT22 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26896-1-AP targets IFT22 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25292 Product name: Recombinant human RABL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC038668 Sequence: MKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT Predict reactive species Full Name: RAB, member RAS oncogene family-like 5 Observed Molecular Weight: 21 kDa GenBank Accession Number: BC038668 Gene Symbol: IFT22 Gene ID (NCBI): 64792 RRID: AB_2880672 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H7X7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.