Iright
BRAND / VENDOR: Proteintech

Proteintech, 26907-1-AP, AMPK Beta 1 Polyclonal antibody

CATALOG NUMBER: 26907-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AMPK Beta 1 (26907-1-AP) by Proteintech is a Polyclonal antibody targeting AMPK Beta 1 in WB, ELISA applications with reactivity to human, mouse, rat samples 26907-1-AP targets AMPK Beta 1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, Jurkat cells, NIH/3T3 cells, HeLa cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information AMPK Beta 1 (5'-AMP-activated protein kinase subunit beta-1) is also named as PRKAB1 and AMPK. AMPK, a serine/threonine kinase that exists as a heterotrimer comprised of a catalytic α-subunit and regulatory β- and γ-subunits, has been recognized as a sensor of cellular energy homeostasis (PMID: 21937710). AMPK regulates key metabolic enzymes, cell growth, apoptosis, gene transcription, and protein synthesis (PMID: 12829246). AMPK is an energy sensor and plays an essential role in the control of cellular bioenergetics by responding to various stresses including those that induce changes in the cellular AMP:ATP ratio or modulation in intracellular calcium (PMID: 27812976, PMID: 26616193). Recent studies have shown that AMPK mediates the inhibition of cell proliferation and growth of tumor cells (PMID: 16613876). AMPK also inhibits the expression of Glut1 and glycolysis in Tregs by inhibiting mTORC1 signaling (PMID: 25477880). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25534 Product name: Recombinant human PRKAB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC001056 Sequence: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN Predict reactive species Full Name: protein kinase, AMP-activated, beta 1 non-catalytic subunit Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC001056 Gene Symbol: PRKAB1 Gene ID (NCBI): 5564 RRID: AB_2880679 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y478 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924