Iright
BRAND / VENDOR: Proteintech

Proteintech, 26912-1-AP, Claudin 2 Polyclonal antibody

CATALOG NUMBER: 26912-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Claudin 2 (26912-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 2 in WB, ELISA applications with reactivity to human samples 26912-1-AP targets Claudin 2 in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, Caco-2 cells, HT-29 cells, HepG2 cells, PANC-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Claudin 2, also named as SP82, belongs to the claudin family. Claudin 2 is a tetraspan membrane protein consisting of two extracellular domains (ECL1 and ECL2), a small intracellular loop connecting the second and third transmembrane sections and short intracellular N and C terminal portions. Claudin 2 is a cation-selective channel forming TJ protein expressed in leaky epithelia. Claudin 2 is a 230 amino acid transmembrane protein, with a calculated molecular mass of 25 kDa (PMID: 31726679) Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25527 Product name: Recombinant human CLDN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-230 aa of BC014424 Sequence: SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV Predict reactive species Full Name: claudin 2 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC014424 Gene Symbol: Claudin 2 Gene ID (NCBI): 9075 RRID: AB_2918115 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57739 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924