Iright
BRAND / VENDOR: Proteintech

Proteintech, 26918-1-AP, Integrin Beta 1/CD29 Polyclonal antibody

CATALOG NUMBER: 26918-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Integrin Beta 1/CD29 (26918-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin Beta 1/CD29 in WB, ELISA applications with reactivity to human, mouse, rat samples 26918-1-AP targets Integrin Beta 1/CD29 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, HT-1080 cells, rat lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25426 Product name: Recombinant human Integrin beta-1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 752-798 aa of BC020057 Sequence: KLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK Predict reactive species Full Name: integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) Calculated Molecular Weight: 88 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC020057 Gene Symbol: Integrin beta 1 Gene ID (NCBI): 3688 ENSEMBL Gene ID: ENSG00000150093 RRID: AB_2880685 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05556 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924