Proteintech, 26921-1-AP, CXorf38 Polyclonal antibody

Size: 20ul / 150ul The CXorf38 (26921-1-AP) by Proteintech is a Polyclonal antibody targeting CXorf38 in WB, ELISA applications with reactivity to human samples 26921-1-AP targets CXorf38 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19527 Product name: Recombinant human CXorf38 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-319 aa of BC025334 Sequence: MVLSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFVGREVLSFHRGLLAAAPGLGPRAVCRGGSRCSPRARQFQPQCQVCAEWKREILRHHVNRNGDVHWGNCRPGRWPVDAWEVAKAFMPRGLADKQGPEECDAVALLSLINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQMKIQNFLNEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDQRDGCECEMGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLRNNEDLRNGLTEDMQKLDSLCLHQKLDSQEPGRQTPDRKA Predict reactive species Full Name: chromosome X open reading frame 38 Calculated Molecular Weight: 319 aa, 35 kDa Observed Molecular Weight: 14 kDa, 20 kDa, 39 kDa GenBank Accession Number: BC025334 Gene Symbol: CXorf38 Gene ID (NCBI): 159013 RRID: AB_2880686 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TB03 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.