Iright
BRAND / VENDOR: Proteintech

Proteintech, 26931-1-AP, Filaggrin Polyclonal antibody

CATALOG NUMBER: 26931-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Filaggrin (26931-1-AP) by Proteintech is a Polyclonal antibody targeting Filaggrin in IHC, ELISA applications with reactivity to human samples 26931-1-AP targets Filaggrin in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human paracancerous of skin squamous cell cancer tissue, human skin squamous cell cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information Profilaggrin is a major protein component of the keratohyalin granules of mammalian epidermis. It is initially expressed as a large polyprotein precursor, which is subsequently proteolytically processed into individual functional filaggrin molecules. The free filaggrin binds to keratin intermediate filaments, causing their aggregation into macrofibrils in which the intermediate filaments are aligned in tightly packed parallel arrays. Mutations in Filaggrin are associated with Ichthyosis vulgaris and Dermatitis atopic 2.(PMID: 19386895, 16550169) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25389 Product name: Recombinant human Filaggrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of NM_002016 Sequence: MRKENLPISGHKHRKHSHHDKHEDNKQEENKENRKRPSSLERRNNRKGNKGRSKSPRETGGKRHESSSEKKERKGYSPTHREEEYGKNHHNSSKKEKNKTEN Predict reactive species Full Name: filaggrin Calculated Molecular Weight: 435 kDa GenBank Accession Number: NM_002016 Gene Symbol: FLG Gene ID (NCBI): 2312 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20930 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924