Proteintech, 26941-1-AP, JAM-A/CD321 Polyclonal antibody

Size: 20ul / 150ul The JAM-A/CD321 (26941-1-AP) by Proteintech is a Polyclonal antibody targeting JAM-A/CD321 in WB, IHC, ELISA applications with reactivity to human samples 26941-1-AP targets JAM-A/CD321 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, human peripheral blood platelets, U-87 MG cells Positive IHC detected in: human breast cancer tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The F11 receptor (F11R) was first identified in human platelets as a 32/35 kDa protein duplex that serves as the receptor for a functional antibody that activates platelets. It seems to play a role in epithelial tight junction formation. It was also reported to function as a receptor for reovirus and ligand for the integrin LFA1. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25641 Product name: Recombinant human F11R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-162 aa of BC001533 Sequence: SVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPS Predict reactive species Full Name: F11 receptor Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC001533 Gene Symbol: F11R Gene ID (NCBI): 50848 RRID: AB_2880692 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y624 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.