Proteintech, 26947-1-AP, PRND Polyclonal antibody

Size: 20ul / 150ul The PRND (26947-1-AP) by Proteintech is a Polyclonal antibody targeting PRND in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, Rat samples 26947-1-AP targets PRND in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, Rat samples. Tested Applications Positive WB detected in: Glucosidase treated mouse testis tissue, mouse testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The prion gene family is mainly composed of three genes; PRNP, encoding the prion protein (PrP), PRND, encoding Doppel (Dpl), both located on the same genomic locus on mouse chromosome 2 and SPRN, encoding Shadoo (Sho), located on mouse chromosome 7. PRND (prion protein 2 also called Doppel) is a membranean N-glycosylated, glycosylphosphatidylinositol-anchored protein that is found predominantly in testis. PRND gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prionprotein, to which it is biochemically and structurally similar. 26947-1-AP antibody detects a 30 kDa glycosylated protein and a 17-20 kDa protein treated by glucosidase. Specification Tested Reactivity: human, mouse, Rat Cited Reactivity: mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25523 Product name: Recombinant human PRND protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-176 aa of BC043644 Sequence: GIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLMVK Predict reactive species Full Name: prion protein 2 (dublet) Calculated Molecular Weight: 176 aa, 20 kDa Observed Molecular Weight: 17-20, 30 kDa GenBank Accession Number: BC043644 Gene Symbol: PRND Gene ID (NCBI): 23627 RRID: AB_2880695 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKY0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.