Iright
BRAND / VENDOR: Proteintech

Proteintech, 26953-1-AP, MCT14 Polyclonal antibody

CATALOG NUMBER: 26953-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MCT14 (26953-1-AP) by Proteintech is a Polyclonal antibody targeting MCT14 in WB, ELISA applications with reactivity to human, pig, mouse samples 26953-1-AP targets MCT14 in WB, ELISA applications and shows reactivity with human, pig, mouse samples. Tested Applications Positive WB detected in: Caco-2 cells, pig kidney tissue, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, pig, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25315 Product name: Recombinant human SLC16A14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 212-312 aa of BC065524 Sequence: LSPGKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKDGGLGNEETLCDLQAQECPDQAGHRKNMCALRILKTVSWLTMRVRKGFEDWYSGYFGTASLFT Predict reactive species Full Name: solute carrier family 16, member 14 (monocarboxylic acid transporter 14) Calculated Molecular Weight: 510 aa, 56 kDa Observed Molecular Weight: 42-52 kDa GenBank Accession Number: BC065524 Gene Symbol: MCT14 Gene ID (NCBI): 151473 RRID: AB_2880701 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7RTX9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924