Proteintech, 26954-1-AP, OR2H1 Polyclonal antibody

Size: 20ul / 150ul The OR2H1 (26954-1-AP) by Proteintech is a Polyclonal antibody targeting OR2H1 in IHC, ELISA applications with reactivity to human samples 26954-1-AP targets OR2H1 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Olfactory receptors (ORs) are part of the G protein-coupled receptor (GPCR) superfamily. Olfactory receptors interact with odor molecules in the nose, initiating neuronal responses that lead to olfactory perception. Olfactory receptor, family 2, subfamily H, member 1(OR2H1) is widely expressed in solid epithelial tumors but not in other normal human tissues except testis (PMID: 35499393). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25268 Product name: Recombinant human OR2H1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-170 aa of BC048991 Sequence: LHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQ Predict reactive species Full Name: olfactory receptor, family 2, subfamily H, member 1 Calculated Molecular Weight: 35 kDa GenBank Accession Number: BC048991 Gene Symbol: OR2H1 Gene ID (NCBI): 26716 RRID: AB_3669577 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZK4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.