Iright
BRAND / VENDOR: Proteintech

Proteintech, 26978-1-AP, DCDC2 Polyclonal antibody

CATALOG NUMBER: 26978-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DCDC2 (26978-1-AP) by Proteintech is a Polyclonal antibody targeting DCDC2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 26978-1-AP targets DCDC2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse placenta tissue, HepG2 cells Positive IHC detected in: human Hepatocellular carcinomaNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information DCDC2 (Doublecortin domain-containing protein 2), also known as KIAA1154. DCDC2 is expressed in the central nervous system of adults and fetuses, especially in the olfactory cortex, inferior temporal cortex, medial temporal cortex, hypothalamus, amygdala and hippocampus. DCDCDC2 protein contains two dicortical protein domains that bind to microtubules and enhance microtubule polymerization, which may play a role in neuronal migration and affect the signal transduction of primary cilia. In addition, DCDC2 also plays a role in inhibiting classical WNT signaling. DCDC2 may affect the development and function of the brain by affecting the migration of neurons and the signal conduction of primary cilia, and then it is related to reading ability (PMID: 21457949). The molecular weight of DCDC2 is 52 kDa, it also has another isoform with a molecular weight of 25 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25577 Product name: Recombinant human DCDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-476 aa of BC050704 Sequence: EDGEKANKDAEQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVNNELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA Predict reactive species Full Name: doublecortin domain containing 2 Calculated Molecular Weight: 476 aa, 53 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC050704 Gene Symbol: DCDC2 Gene ID (NCBI): 51473 RRID: AB_2880709 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHG0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924