Proteintech, 26984-1-AP, Collagen Type X Polyclonal antibody

Size: 20ul / 150ul The Collagen Type X (26984-1-AP) by Proteintech is a Polyclonal antibody targeting Collagen Type X in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26984-1-AP targets Collagen Type X in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells, ROS1728 cells, HCT 116 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Collagen type X alpha 1 (COL10A1), a secreted, short-chain collagen, belongs to the collagen family, which is a major interstitial matrix component specifically expressed by hypertrophic chondrocytes. COL10A1 expression is elevated in many solid tumor types, such as colon cancer, esophagus cancer, and breast cancer, and displays vital roles in many critical cellular processes (PMID: 30154451, 25321476). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25741 Product name: Recombinant human COL10A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 518-585 aa of BC130621 Sequence: QAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPR Predict reactive species Full Name: collagen, type X, alpha 1 Calculated Molecular Weight: 680 aa, 66 kDa Observed Molecular Weight: 60-66 kDa GenBank Accession Number: BC130621 Gene Symbol: COL10A1 Gene ID (NCBI): 1300 RRID: AB_3085918 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q03692 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.