Iright
BRAND / VENDOR: Proteintech

Proteintech, 26989-1-AP, RRAGC Polyclonal antibody

CATALOG NUMBER: 26989-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RRAGC (26989-1-AP) by Proteintech is a Polyclonal antibody targeting RRAGC in WB, ELISA applications with reactivity to human, mouse samples 26989-1-AP targets RRAGC in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, NIH/3T3 cells, HEK-293T cells, HeLa cells, K-562 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information RRAGC (Ras-related GTP-binding protein C) is a small monomeric GTPase that functions as part of the mTORC1 nutrient-sensing pathway. Together with its dimerization partners RRAGA or RRAGB, RRAGC localizes mainly to the cytoplasm and, in response to amino-acid availability, recruits the mTORC1 complex to the lysosomal surface where mTORC1 can be activated by Rheb. This makes RRAGC a key molecular switch linking cellular metabolic state to growth control. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25780 Product name: Recombinant human RRAGC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-54 aa of BC016668 Sequence: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGP Predict reactive species Full Name: Ras-related GTP binding C Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC016668 Gene Symbol: RRAGC Gene ID (NCBI): 64121 RRID: AB_2880714 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HB90 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924