Iright
BRAND / VENDOR: Proteintech

Proteintech, 27004-1-AP, NUDT5 Polyclonal antibody

CATALOG NUMBER: 27004-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NUDT5 (27004-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 27004-1-AP targets NUDT5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells, MCF-7 cels, MDA-MB-231 cells, T-47D cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NUDT5 (NUDIX hydrolase type 5), also called NUDIX5, is a member of the nudix hydrolase family which eliminate toxic nucleotide derivatives from the cell. NUDT5 expression can affect chromosome remodeling, involved in cell adhesion, cancer stem cell maintenance and epithelial to mesenchyme transition in breast cancer cells. In addtion, the high expression of NUDT5 is probably involved in the poor prognosis of breast cancer, which could be a prognostic factor and potential target in the diagnosis and treatment of breast cancer (PMID: 33571243). This NUDT5 protein can be detected with a molecular weight of 35 kDa (PMID: 33096144). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25485 Product name: Recombinant human NUDT5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC000025 Sequence: MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 5 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC000025 Gene Symbol: NUDT5 Gene ID (NCBI): 11164 RRID: AB_3085919 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKK9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924