Iright
BRAND / VENDOR: Proteintech

Proteintech, 27012-1-AP, MKX Polyclonal antibody

CATALOG NUMBER: 27012-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MKX (27012-1-AP) by Proteintech is a Polyclonal antibody targeting MKX in WB, ELISA applications with reactivity to human samples 27012-1-AP targets MKX in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Mohawk (Mkx) is a member of the Three Amino Acid Loop Extension (TALE) superclass of atypical homeobox genes. It encodes a transcriptional repressor that is expressed in the embryonic precursors of skeletal muscle, tendon, cartilage, and bone. This gene is highly conserved across species and is known to be involved in the differentiation and maintenance of these tissues. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25549 Product name: Recombinant human MKX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-352 aa of BC036207 Sequence: GVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNHSGSFSSNEFEEELVSPSSSETEGNFVYRTDTLENGSNKGESAANRKGPSKDDTYWKEINAAMALTNLAQGKDKLQGTTSCIIQKSSHIAEVKTVKVPLVQQF Predict reactive species Full Name: mohawk homeobox Calculated Molecular Weight: 352 aa, 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC036207 Gene Symbol: MKX Gene ID (NCBI): 283078 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYA7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924