Proteintech, 27018-1-AP, RNF113A Polyclonal antibody

Size: 20ul / 150ul The RNF113A (27018-1-AP) by Proteintech is a Polyclonal antibody targeting RNF113A in WB, IHC, ELISA applications with reactivity to human samples 27018-1-AP targets RNF113A in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, MCF-7 cells, HEK-293T cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25313 Product name: Recombinant human RNF113A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 41-100 aa of BC000832 Sequence: GESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVY Predict reactive species Full Name: ring finger protein 113A Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC000832 Gene Symbol: RNF113A Gene ID (NCBI): 7737 RRID: AB_2880724 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15541 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.