Proteintech, 27020-1-AP, SHQ1 Polyclonal antibody

Size: 20ul / 150ul The SHQ1 (27020-1-AP) by Proteintech is a Polyclonal antibody targeting SHQ1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 27020-1-AP targets SHQ1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, A549 cells, HEK-293T cells Positive IP detected in: K-562 cells Positive IHC detected in: human colon cancer tissue, human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25559 Product name: Recombinant human SHQ1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-214 aa of BC017274 Sequence: MLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLRLTLPGRIVENGSEQGSYDADKGIFTIRLPKETPGQHFEGLNMLTALLAPRKSRTAKPLVEEIGASEIPEEVVDDEEFDWEIEQTPCEEVSESALNPQCHYGFGNLRSGVLQRLQDELSDVIDIKDPDFTPAAERRQKRLAAELAKFDPDHYLADFFEDEAIEQILK Predict reactive species Full Name: SHQ1 homolog (S. cerevisiae) Calculated Molecular Weight: 593 aa, 67 kDa Observed Molecular Weight: 70 kDa~80 kDa GenBank Accession Number: BC017274 Gene Symbol: SHQ1 Gene ID (NCBI): 55164 RRID: AB_2880725 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PI26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.