Iright
BRAND / VENDOR: Proteintech

Proteintech, 27044-1-AP, EMR1 Polyclonal antibody

CATALOG NUMBER: 27044-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EMR1 (27044-1-AP) by Proteintech is a Polyclonal antibody targeting EMR1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 27044-1-AP targets EMR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: unboiled RAW 264.7 cells, HL-60 cells Positive IHC detected in: mouse spleen tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: mouse peritoneal macrophages Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information EMR1 (EGF-like module containing mucin-like hormone receptor 1), also known as Adhesion G protein-coupled receptor E1 (ADGRE1), is a surface receptor with seven transmembrane segments that belong to the EGF-7-transmembrane family of G protein-coupled receptors (PMID: 14647991, 7601460). EMR1 expression is restricted to eosinophilic granulocytes, where expression is overlapping with the eotaxin receptor CCR3 and the immunoglobulin-like lectin Siglec-8. Absence on other leukocytes, including basophils, implies that EMR1 is a highly specific marker for eosinophils in humans and may be used as a novel therapeutic target for eosinophilic disorders (PMID: 17823986, 24530099). F4/80, the murine homolog of EMR1, is a marker of murine macrophage. The apparent molecular weight of F4/80 is 160 kDa, which is larger than the calculated molecular weight due to post-translational modifications (PMID: 7308288; 8647179). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25883 Product name: Recombinant human EMR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-510 aa of BC059395 Sequence: TEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLK Predict reactive species Full Name: egf-like module containing, mucin-like, hormone receptor-like 1 Calculated Molecular Weight: 886 aa, 97 kDa Observed Molecular Weight: 160 kDa GenBank Accession Number: BC059395 Gene Symbol: EMR1 Gene ID (NCBI): 2015 RRID: AB_2716814 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14246 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924