Iright
BRAND / VENDOR: Proteintech

Proteintech, 27065-1-AP, TANK Polyclonal antibody

CATALOG NUMBER: 27065-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TANK (27065-1-AP) by Proteintech is a Polyclonal antibody targeting TANK in WB, ELISA applications with reactivity to human samples 27065-1-AP targets TANK in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25740 Product name: Recombinant human TANK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC003388 Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI Predict reactive species Full Name: TRAF family member-associated NFKB activator Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC003388 Gene Symbol: TANK Gene ID (NCBI): 10010 RRID: AB_2880738 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92844 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924