Iright
BRAND / VENDOR: Proteintech

Proteintech, 27069-1-AP, DMBT1 Polyclonal antibody

CATALOG NUMBER: 27069-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DMBT1 (27069-1-AP) by Proteintech is a Polyclonal antibody targeting DMBT1 in IHC, IF-P, ELISA applications with reactivity to human samples 27069-1-AP targets DMBT1 in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human stomach cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Deleted in malignant brain tumors 1 (DMBT1), also known as the salivary scavenger and agglutinin (SALSA), salivary agglutinin (SAG) or gp340, is a multifunctional molecule with important functions in innate immunity, inflammation and epithelial homeostasis (PMID: 28668353). DMBT1 has some isoforms with the molecular weight of 193, 260 and 340 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16229 Product name: Recombinant human DMBT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1313-1662 aa of BC153299 Sequence: IEVFDGPYRSSPLIARVCDGARGSFTSSSNFMSIRFISDHSITRRGFRAEYYSSPSNDSTNLLCLPNHMQASVSRSYLQSLGFSASDLVISTWNGYYECRPQITPNLVIFTIPYSGCGTFKQADNDTIDYSNFLTAAVSGGIIKRRTDLRIHVSCRMLQNTWVDTMYIANDTIHVANNTIQVEEVQYGNFDVNISFYTSSSFLYPVTSRPYYVDLNQDLYVQAEILHSDAVLTLFVDTCVASPYSNDFTSLTYDLIRSGCVRDDTYGPYSSPSLRIARFRFRAFHFLNRFPSVYLRCKMVVCRAYDPSSRCYRGCVSRSKRDVGSYQEKVDVVLGPIQLQTPPRREEEPR Predict reactive species Full Name: deleted in malignant brain tumors 1 Calculated Molecular Weight: 2413 aa, 261 kDa GenBank Accession Number: BC153299 Gene Symbol: DMBT1 Gene ID (NCBI): 1755 RRID: AB_2880741 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UGM3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924