Proteintech, 27073-1-AP, BUB3 Polyclonal antibody

Size: 20ul / 150ul The BUB3 (27073-1-AP) by Proteintech is a Polyclonal antibody targeting BUB3 in WB, IHC, ELISA applications with reactivity to human, rat samples 27073-1-AP targets BUB3 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, MCF-7 cells, C6 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25608 Product name: Recombinant human BUB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 205-328 aa of BC005138 Sequence: VEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT Predict reactive species Full Name: budding uninhibited by benzimidazoles 3 homolog (yeast) Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC005138 Gene Symbol: BUB3 Gene ID (NCBI): 9184 RRID: AB_2880743 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43684 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.