Iright
BRAND / VENDOR: Proteintech

Proteintech, 27083-1-AP, SCRIB Polyclonal antibody

CATALOG NUMBER: 27083-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCRIB (27083-1-AP) by Proteintech is a Polyclonal antibody targeting SCRIB in WB, IHC, ELISA applications with reactivity to human, mouse samples 27083-1-AP targets SCRIB in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SCRIB encodes a large, 260-kDa cytoplasmic scaffolding protein that comprises a large leucine-rich repeat (LRR) region and 4 PDZ domains that regulate protein-protein interactions. In mammals, cell polarity is established and maintained by at least 3 protein modules (Scrib, Crumbs, and Par). The apical (Crumbs and Par) and basolateral (Scrib) modules function in a mutually antagonistic relationship to regulate various polarization processes such as apical-basal polarity, planar cell polarity, asymmetric cell division and migration. The loss of SCRIB in malignant tumors suggest that it has potential to be a tumor suppressor. Alteration of polarity through deletion, downregulation, overexpression, and mislocalization can induce structural and functional alteration of cells that might be related to tumorigenesis. Mislocalization of SCRIB is involved in epithelial-to-mesenchymal transition (EMT) by inducing loss of E-cadherin. Deregulated SCRIB expression induces tumorigenesis in breast and liver. (PMID: 28460446, PMID: 32564009) Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25795 Product name: Recombinant human SCRIB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1331-1630 aa of BC036905 Sequence: HPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREAAEAGAEARLALDGETLGEEEQEDEQPPWASPSPTSRQSPASPPPLGGGAPVRTAKAERRHQERLRVQSPEPPAPERALSPAELRALEAEKRALWRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTSTSPGRLSPDFAEELRSLEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVALCSSRRPVRPGRRGLGPVPS Predict reactive species Full Name: scribbled homolog (Drosophila) Calculated Molecular Weight: 1630 aa, 175 kDa Observed Molecular Weight: 260 kDa GenBank Accession Number: BC036905 Gene Symbol: SCRIB Gene ID (NCBI): 23513 RRID: AB_2880749 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14160 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924