Proteintech, 27084-1-AP, Pericentrin Polyclonal antibody

Size: 20ul / 150ul The Pericentrin (27084-1-AP) by Proteintech is a Polyclonal antibody targeting Pericentrin in IHC, IF/ICC, ELISA applications with reactivity to human samples 27084-1-AP targets Pericentrin in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PCNT, also named as KIAA0402, PCNT2, Pericentrin-B and Kendrin, is an integral component of the filamentous matrix of the centrosome involved in the initial establishment of organized microtubule arrays in both mitosis and meiosis. PCNT plays a role, together with DISC1, in the microtubule network formation. PCNT is a marker of centrosome. Defects in PCNT are the cause of microcephalic osteodysplastic primordial dwarfism type 2 (MOPD2). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25888 Product name: Recombinant human PCNT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-200 aa of AK093923 Sequence: MDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTI Predict reactive species Full Name: pericentrin Calculated Molecular Weight: 378 kDa GenBank Accession Number: AK093923 Gene Symbol: Pericentrin Gene ID (NCBI): 5116 RRID: AB_3085924 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95613 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.