Proteintech, 27087-1-AP, Neurocan Polyclonal antibody

Size: 20ul / 150ul The Neurocan (27087-1-AP) by Proteintech is a Polyclonal antibody targeting Neurocan in WB, ELISA applications with reactivity to human samples 27087-1-AP targets Neurocan in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25821 Product name: Recombinant human Neurocan protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 451-550 aa of NM_004386 Sequence: MVAPSPSDMGAGTAASSHTEVAPTDPMPRRRGRFKGLNGRYFQQQEPEPGLQGGMEASAQPPTSEAAVNQMEPPLAMAVTEMLGSGQSRSPWADLTNEVDM Predict reactive species Full Name: neurocan Calculated Molecular Weight: 143 kDa Observed Molecular Weight: 270 kDa GenBank Accession Number: NM_004386 Gene Symbol: Neurocan Gene ID (NCBI): 1463 RRID: AB_2880751 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14594 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.