Product Description
Size: 20ul / 150ul
The RAB10 (27094-1-AP) by Proteintech is a Polyclonal antibody targeting RAB10 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, canine samples
27094-1-AP targets RAB10 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, canine samples.
Tested Applications
Positive WB detected in: MCF-7 cells, HeLa cells, MDCK cells, mouse brain tissue, rat brain tissue
Positive IHC detected in: human colon tissue, human hepatocellular carcinomaNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: NIH/3T3 cells, MCF-7 cells
Positive FC (Intra) detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Background Information
RAB10 is a member of the RAB family of small GTPases, which are key regulators of vesicular trafficking. RAB proteins are cyclically controlled, requiring a GDP-GTP exchange that is facilitated by RAB guanine nucleotide exchange factors. Rab10 plays essential functional roles in development: mice are embryonic lethal when both alleles are deleted. In addition, RAB10 plays a role in maintenance and regulation of endoplasmic reticulum (ER) morphology. RAB10 function has also been linked to neuronal morphology and polarization, playing a critical role in axonal development and dendrite arborization.
Specification
Tested Reactivity: human, mouse, rat, canine
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25830 Product name: Recombinant human RAB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-200 aa of BC000896 Sequence: RVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC Predict reactive species
Full Name: RAB10, member RAS oncogene family
Calculated Molecular Weight: 200 aa, 23 kDa
Observed Molecular Weight: 23 kDa
GenBank Accession Number: BC000896
Gene Symbol: RAB10
Gene ID (NCBI): 10890
RRID: AB_2880752
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P61026
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924