Product Description
Size: 20ul / 150ul
The Cytokeratin 8 (27105-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
27105-1-AP targets Cytokeratin 8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells
Positive IHC detected in: human tonsillitis tissue, human colon tissue, mouse skin tissue, rat skin tissue, human brown diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:16000
Immunohistochemistry (IHC): IHC : 1:2000-1:8000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. KRT8 is often paired with keratin 18 in vivo.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25844 Product name: Recombinant human KRT8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 11-50 aa of BC008200 Sequence: EGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSL Predict reactive species
Full Name: keratin 8
Calculated Molecular Weight: 54 kDa
Observed Molecular Weight: 52 kDa
GenBank Accession Number: BC008200
Gene Symbol: Cytokeratin 8
Gene ID (NCBI): 3856
RRID: AB_2918117
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P05787
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924