Iright
BRAND / VENDOR: Proteintech

Proteintech, 27124-1-AP, ADAM15 Polyclonal antibody

CATALOG NUMBER: 27124-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADAM15 (27124-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM15 in WB, ELISA applications with reactivity to human samples 27124-1-AP targets ADAM15 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information ADAM15, a member of the ADAM (a disintegrin and metalloprotease) family, is a membrane protein containing both protease and adhesion domains and may be involved in tumor invasion and metastasis (PMID:15756594). It is also named as MDC15. ADAM15 is required for the activation of the FAK and Src pathways to generate apoptosis resistance in response to apoptotic signalling or cell stress (PMID: 11741929). ADAM15 is processed during epididymal maturation and acrosome reaction and that it may play a role during sperm-egg binding. Jurkat and testicular cells expresses the precursor ADAM15 of 110 kDa, as well as the ADAM15 processing form, consisting of about 75-85 kDa (PMID:18390692). ADAM15 has some isoforms with the calculated molecular mass of 55~92 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25947 Product name: Recombinant human ADAM15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 362-486 aa of BC014566 Sequence: GNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGD Predict reactive species Full Name: ADAM metallopeptidase domain 15 Calculated Molecular Weight: 93 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC014566 Gene Symbol: ADAM15 Gene ID (NCBI): 8751 RRID: AB_2923577 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13444 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924