Iright
BRAND / VENDOR: Proteintech

Proteintech, 27131-1-AP, FAM3B Polyclonal antibody

CATALOG NUMBER: 27131-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM3B (27131-1-AP) by Proteintech is a Polyclonal antibody targeting FAM3B in WB, IHC, ELISA applications with reactivity to human, mouse samples 27131-1-AP targets FAM3B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human milk tissue Positive IHC detected in: human pancreas tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAM3B, also known as Pancreatic-derived factor (PANDER), is a secreted glycoprotein that belongs to the cytokine like-protein family. There are four members in this gene family (FAM3A, FAM3B, FAM3C and FAM3D). As a result of alternative splicing and alternate signal peptide cleavage sites, multiple isoforms are known. FAM3B is selectively expressed at a high level in pancreatic islets and at low levels in the small intestine, prostate, and certain neurons. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25955 Product name: Recombinant human FAM3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-235 aa of BC057829 Sequence: RQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS Predict reactive species Full Name: family with sequence similarity 3, member B Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa, 23 kDa GenBank Accession Number: BC057829 Gene Symbol: FAM3B Gene ID (NCBI): 54097 RRID: AB_2880766 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58499 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924