Proteintech, 27155-1-AP, Caspase 7 Polyclonal antibody

Size: 20ul / 150ul The Caspase 7 (27155-1-AP) by Proteintech is a Polyclonal antibody targeting Caspase 7 in WB, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 27155-1-AP targets Caspase 7 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, LNCaP cells, PC-3 cells, MCF-7 cells, mouse liver tissue Positive IP detected in: HEK-293 cells Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Caspase 7(CASP7), like caspases 3 and 6, contains a short prodomain and, upon apoptotic induction, the 35 kDa proform is converted into a 32 kDa intermediate or preactive form which is further processed into two active subunits consisting of the p20 or large (18 kDa) subunit and the p10 or small (11 kDa) subunit and it is present in the brain, which is up-regulated and activated after traumatic injury(PMID:15953353). Caspase-7 is classified as a member of the subgroup of cysteine proteases most related to the Caenorhabditis elegans factor CED-3, which also includes caspase-3, -6, and -9(PMID:9426061). The protein is involved in the activation cascade of caspases responsible for apoptosis execution. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25904 Product name: Recombinant human Caspase 7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC015799 Sequence: MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC Predict reactive species Full Name: caspase 7, apoptosis-related cysteine peptidase Calculated Molecular Weight: 303 aa, 34 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC015799 Gene Symbol: Caspase 7 Gene ID (NCBI): 840 RRID: AB_2880779 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55210 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.